DTD2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DTD2 Antibody [NBP2-14375] - Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Immunohistochemistry-Paraffin: DTD2 Antibody [NBP2-14375] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: DTD2 Antibody [NBP2-14375] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: DTD2 Antibody [NBP2-14375] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: DTD2 Antibody [NBP2-14375] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DTD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: WVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIFE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DTD2 Protein (NBP2-14375PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DTD2 Antibody

  • C14orf126
  • chromosome 14 open reading frame 126
  • EC 3.1
  • MGC9912
  • probable D-tyrosyl-tRNA(Tyr) deacylase 2

Background

Hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). Could be a defense mechanism against aharmful effect of D-tyrosine (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35324
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-49271
Species: Hu
Applications: IHC, IHC-P, WB
NB200-209
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-14375
Species: Hu
Applications: ICC/IF, IHC

Publications for DTD2 Antibody (NBP2-14375) (0)

There are no publications for DTD2 Antibody (NBP2-14375).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTD2 Antibody (NBP2-14375) (0)

There are no reviews for DTD2 Antibody (NBP2-14375). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DTD2 Antibody (NBP2-14375) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DTD2 Products

Diseases for DTD2 Antibody (NBP2-14375)

Discover more about diseases related to DTD2 Antibody (NBP2-14375).
 

Pathways for DTD2 Antibody (NBP2-14375)

View related products by pathway.

Blogs on DTD2

There are no specific blogs for DTD2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DTD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTD2