![Western Blot: DMRTB1 Antibody [H00063948-B02P] - Analysis of DMRTB1 expression in human liver.](http://images.novusbio.com/fullsize/DMRTB1-Antibody-Western-Blot-H00063948-B02P-img0001.jpg "Western Blot: DMRTB1 Antibody [H00063948-B02P] - Analysis of DMRTB1 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse DMRTB1 Antibody - Azide and BSA Free (H00063948-B02P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | DMRTB1 (AAH29566.1, 1 a.a. - 189 a.a.) full-length human protein. MPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD |
| Specificity | This product is specific for Human DMRTB1 purified MaxPab mouse polyclonal antibody (B02P) [Gene ID: 63948]. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | DMRTB1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Mouse polyclonal antibody raised against a full-length human DMRTB1 protein. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DMRTB1 |
| Uniprot |
|
![Western Blot: DMRTB1 Antibody [H00063948-B02P] - Analysis of DMRTB1 expression in transfected 293T cell line by DMRTB1 polyclonal antibody. Lane 1: DMRTB1 transfected lysate(20.10 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/DMRTB1-Antibody-Western-Blot-H00063948-B02P-img0002.jpg "Western Blot: DMRTB1 Antibody [H00063948-B02P] - Analysis of DMRTB1 expression in transfected 293T cell line by DMRTB1 polyclonal antibody. Lane 1: DMRTB1 transfected lysate(20.10 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")