DIS3L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DIS3L Antibody [NBP1-81941] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & centrosome.
Immunohistochemistry-Paraffin: DIS3L Antibody [NBP1-81941] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIS3L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHE
Specificity
Specificity of human DIS3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIS3L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DIS3L Protein (NBP1-81941PEP)
Publications
Read Publication using NBP1-81941.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24150935)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIS3L Antibody

  • DIS3 mitotic control homolog (S. cerevisiae)-like
  • DIS3-like exonuclease 1
  • EC 3.1.13
  • FLJ38088
  • KIAA1955EC 3.1.13.-
  • MGC4562

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00022894-B01P
Species: Hu, Ch
Applications: WB, ELISA, ICC/IF
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-84740
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81941
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for DIS3L Antibody (NBP1-81941)(1)

Reviews for DIS3L Antibody (NBP1-81941) (0)

There are no reviews for DIS3L Antibody (NBP1-81941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DIS3L Antibody (NBP1-81941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DIS3L Antibody (NBP1-81941)

Discover related pathways, diseases and genes to DIS3L Antibody (NBP1-81941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DIS3L Antibody (NBP1-81941)

View related products by pathway.

Blogs on DIS3L

There are no specific blogs for DIS3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIS3L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIS3L