DHRS1 Antibody - BSA Free

Western Blot: DHRS1 Antibody [NBP2-87268] - Host: Rabbit. Target Name: DHRS1. Sample Tissue: Human PC-3 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

DHRS1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DHRS1. Peptide sequence: SLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DHRS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DHRS1 Antibody - BSA Free

• dehydrogenase/reductase (SDR family) member 1
• dehydrogenase/reductase SDR family member 1
• DKFZp586I0523
• EC 1.1
• FLJ14250
• FLJ25430
• MGC20204
• SDR19C1
• short chain dehydrogenase/reductase family 19C, member 1

Background

DHRS1 encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DHRS1