Recombinant Human DDI2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human DDI2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-211 of Human DDI2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLLTVYCVRRDLSEVTFSLQVDADFELHNFRALCELESGIPAAESQIVYAERPLTDNHRSLASYGLKDGDVVILRQKENADPRPPVQFPNLPRIDFSSIAVPGTSSPRQRQPPGTQQSHSSPGEITSSPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGDLEKFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DDI2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
50.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DDI2 Protein

  • DDI1, DNA-damage inducible 1, homolog 2 (S. cerevisiae)
  • DDI1, DNA-damage inducible 1, homolog 2
  • DNA-damage inducible 1 homolog 2 (S. cerevisiae)
  • DNA-damage inducible protein 2 (DDI2)
  • MGC14844
  • protein DDI1 homolog 2
  • RP4-680D5.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86944
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-77101
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006947-M12
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92084
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-81657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-56547
Species: Hu
Applications: ICC/IF

Publications for DDI2 Recombinant Protein (H00084301-P01) (0)

There are no publications for DDI2 Recombinant Protein (H00084301-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDI2 Recombinant Protein (H00084301-P01) (0)

There are no reviews for DDI2 Recombinant Protein (H00084301-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDI2 Recombinant Protein (H00084301-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array H00084301-P01

Bioinformatics Tool for DDI2 Recombinant Protein (H00084301-P01)

Discover related pathways, diseases and genes to DDI2 Recombinant Protein (H00084301-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDI2 Recombinant Protein (H00084301-P01)

Discover more about diseases related to DDI2 Recombinant Protein (H00084301-P01).

Blogs on DDI2

There are no specific blogs for DDI2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDI2 Antibody
NBP2-47493

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DDI2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DDI2