CTL5 Antibody


Immunohistochemistry: CTL5 Antibody [NBP2-30869] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CTL5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VPVYKVIAPGGHCIHENQTCDPEIFNTTEIAKACPGALCNFAFYGGKSLYHQYI
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CTL5 Protein (NBP2-30869PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CTL5 Antibody

  • Choline Transporter-Like Protein 5
  • SLC44A5
  • Solute Carrier Family 44 Member 5
  • Solute Carrier Family 44, Member 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bt, Ch, Eq, Rb
Applications: IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for CTL5 Antibody (NBP2-30869) (0)

There are no publications for CTL5 Antibody (NBP2-30869).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTL5 Antibody (NBP2-30869) (0)

There are no reviews for CTL5 Antibody (NBP2-30869). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CTL5 Antibody (NBP2-30869) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CTL5 Products

CTL5 NBP2-30869

Bioinformatics Tool for CTL5 Antibody (NBP2-30869)

Discover related pathways, diseases and genes to CTL5 Antibody (NBP2-30869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTL5 Antibody (NBP2-30869)

Discover more about diseases related to CTL5 Antibody (NBP2-30869).

Pathways for CTL5 Antibody (NBP2-30869)

View related products by pathway.

Blogs on CTL5

There are no specific blogs for CTL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CTL5 Antibody and receive a gift card or discount.


Gene Symbol SLC44A5