CSN7b Antibody - BSA Free

Western Blot: CSN7b Antibody [NBP2-38214] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Immunocytochemistry/Immunofluorescence: CSN7b Antibody [NBP2-38214] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry: CSN7b Antibody [NBP2-38214] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CSN7b Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CSN7b Antibody - BSA Free (NBP2-38214) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLV
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COPS7B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CSN7b Protein (NBP2-38214PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CSN7b Antibody - BSA Free

• Arabidopsis, homolog) subunit 7B
• COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis)
• COP9 signalosome complex subunit 7b
• CSN7BMGC111077
• FLJ12612
• Signalosome subunit 7b

Background

Component of the COP9 signalosome complex (CSN), is a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COPS7B
• Uniprot:
  • Q9H9Q2(Human)