Recombinant Human CRYBA2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human CRYBA2 Protein [H00001412-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human CRYBA2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-197 of Human CRYBA2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CRYBA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
47.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CRYBA2 GST (N-Term) Protein

  • Beta-A2 crystallin
  • beta-crystallin A2
  • crystallin, beta A2
  • eye lens structural protein

Background

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported. CRYBA2( AAH06285, 1 a.a. - 198 a.a.) recombinant protein with GST. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2519
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-46354
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-07779
Species: Hu
Applications: WB
H00001421-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP3-03301
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-84375
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP1-33010
Species: Mu
Applications: ICC/IF, WB
NBP2-13876
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-68576
Species: Hu, Mu
Applications: IHC,  IHC-P
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-32741
Species: Hu, Mu
Applications: ICC/IF, WB
NBP3-48104
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-17113
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB5695
Species: Hu, Mu
Applications: WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-58660
Species: Hu
Applications: IHC,  IHC-P

Publications for CRYBA2 Recombinant Protein (H00001412-P01) (0)

There are no publications for CRYBA2 Recombinant Protein (H00001412-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRYBA2 Recombinant Protein (H00001412-P01) (0)

There are no reviews for CRYBA2 Recombinant Protein (H00001412-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRYBA2 Recombinant Protein (H00001412-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRYBA2 Products

Research Areas for CRYBA2 Recombinant Protein (H00001412-P01)

Find related products by research area.

Blogs on CRYBA2

There are no specific blogs for CRYBA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CRYBA2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYBA2