CRAMP1L Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CRAMP1L Antibody [NBP1-93589] - Staining of human cell line U-2 OS shows positivity in nucleus, nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: CRAMP1L Antibody [NBP1-93589] - Staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CRAMP1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRNPPRPLLVPGPSSTGSNDSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLNSISMQSDFFLPKPRKLRNRHLRKPLVVQRTLLPRPSENQSHN
Specificity
Specificity of human CRAMP1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CRAMP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CRAMP1L Protein (NBP1-93589PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CRAMP1L Antibody

  • C16orf34
  • Crm, cramped-like (Drosophila)
  • KIAA1426
  • MGC176736
  • protein cramped-like
  • TCE4
  • T-complex expressed gene 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89688
Species: Hu
Applications: WB, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP2-66064
Species: Hu
NBP1-93589
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for CRAMP1L Antibody (NBP1-93589) (0)

There are no publications for CRAMP1L Antibody (NBP1-93589).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRAMP1L Antibody (NBP1-93589) (0)

There are no reviews for CRAMP1L Antibody (NBP1-93589). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CRAMP1L Antibody (NBP1-93589) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CRAMP1L Antibody (NBP1-93589)

Discover related pathways, diseases and genes to CRAMP1L Antibody (NBP1-93589). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CRAMP1L

There are no specific blogs for CRAMP1L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRAMP1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRAMP1L