CPXM2 Antibody (3E4) - Azide and BSA Free

• Reactivity: Hu
• Applications: ELISA
• Clone: 3E4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CPXM2 Antibody (3E4) - Azide and BSA Free Summary

• Immunogen: CPXM2 (NP_937791, 190 a.a. ~ 279 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLQQWIEVDARRLTRFTGVITQGRNSLWLSDWVTSYKVMVSNDSHTWVTVKNGSGDMIFEGNSEKEIPVLNELPVPMVARYIRINPQSWF
• Specificity: CPXM2 (3E4)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CPXM2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CPXM2 Antibody (3E4) - Azide and BSA Free

• carboxypeptidase Hlo
• carboxypeptidase X (M14 family), member 2
• carboxypeptidase-like protein X2
• EC 3.4.17
• EC 3.4.17.3
• inactive carboxypeptidase-like protein X2,4632435C11Rik
• UNQ676

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPXM2
• Entrez:
  • 119587(Human)
• Uniprot:
  • NP_937791(Human)