CPNE5 Antibody - BSA Free

Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP1-84406 antibody. Corresponding CPNE5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human skeletal muscle shows no granular cytoplasmic positivity in myocytes as expected.

Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human caudate shows strong granular cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human cerebellum shows moderate granular ctyoplasmic positivity in purkinje cells.

Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human cortex shows moderate granular cytoplasmic positivity in neuronal cells and neuropil.

Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CPNE5 Antibody [NBP1-84406] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.

Staining of human cell line A-431 shows localization to cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CPNE5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CPNE5 Antibody - BSA Free (NBP1-84406) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-CPNE5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQW
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPNE5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CPNE5 Protein (NBP1-84406PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:31284824).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CPNE5 Antibody - BSA Free

• copine VKIAA1599CPN5COPN5
• copine-5
• DKFZp666C234

Background

Copine 5 or Copine V (CPNE5) is a member of the copine family. The copines are ubiquitous, Ca2+ dependent, phospholipid-binding proteins. Due to the copine's phospholipid binding capabilities, it is thought that they play a role in membrane trafficking. CPNE5 contains two N-terminal type II C2 domains and, in the C-terminus, an integrin A domain-like sequence. Recent studies with Arabidopsis suggest that copines may also play a role in cell division and growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CPNE5 Antibody (NBP1-84406)(1)

Publication using NBP1-84406

• Goodyer W R, Beyersdorf B M et al. Transcriptomic Profiling of the Developing Cardiac Conduction System at Single-Cell Resolution. Circ Res 2019-02-08 [PMID: 31284824] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: CPNE5