Recombinant Human COQ4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human COQ4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-265 of Human COQ4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
COQ4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human COQ4 Protein

  • CGI-92
  • Coenzyme Q biosynthesis protein 4 homolog
  • coenzyme Q4 homolog (S. cerevisiae)
  • coenzyme Q4 homolog (yeast)
  • ubiquinone biosynthesis protein COQ4 homolog, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88724
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP2-13860
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13859
Species: Hu
Applications: WB, IHC, IHC-P
UL-950
Species: Hu
NBP2-55409
Species: Hu
Applications: WB, ICC/IF
MAB3650
Species: Hu
Applications: Flow, CyTOF-ready
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-88450
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-15659
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37956
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-30865
Species: Hu
Applications: WB, IHC, IHC-P

Publications for COQ4 Recombinant Protein (H00051117-P01) (0)

There are no publications for COQ4 Recombinant Protein (H00051117-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COQ4 Recombinant Protein (H00051117-P01) (0)

There are no reviews for COQ4 Recombinant Protein (H00051117-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COQ4 Recombinant Protein (H00051117-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COQ4 Products

Bioinformatics Tool for COQ4 Recombinant Protein (H00051117-P01)

Discover related pathways, diseases and genes to COQ4 Recombinant Protein (H00051117-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COQ4 Recombinant Protein (H00051117-P01)

Discover more about diseases related to COQ4 Recombinant Protein (H00051117-P01).
 

Pathways for COQ4 Recombinant Protein (H00051117-P01)

View related products by pathway.

PTMs for COQ4 Recombinant Protein (H00051117-P01)

Learn more about PTMs related to COQ4 Recombinant Protein (H00051117-P01).

Blogs on COQ4

There are no specific blogs for COQ4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ABCA1 Antibody
NB400-105
COQ4 Antibody
NBP1-91806

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human COQ4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ4