We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

COG1 Recombinant Protein Antigen

Images

 
There are currently no images for COG1 Protein (NBP1-81414PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

COG1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COG1.

Source: E. coli

Amino Acid Sequence: FCSALDSKLKVKLDDLLAYLPSDDSSLPKDVSPTQAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQDALNSAKLHSVLFMA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81414.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COG1 Recombinant Protein Antigen

  • COG complex subunit 1
  • component of oligomeric golgi complex 1CDG2G
  • conserved oligomeric Golgi complex subunit 1
  • KIAA1381DKFZp762L1710
  • LDLBconserved oligomeric Golgi complex protein 1
  • low density lipoprotein receptor defect B complementing

Background

COG1 is encoded by this gene is one of eight proteins (Cog1-8) which form a Golgi-localized complex (COG) required for normal Golgi morphology and function. It is thought that this protein is required for steps in the normal medial and trans Golgi-associated processing of glycoconjugates and plays a role in the organization of the Golgi-localized complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-38235
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-15937
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-36949
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-93713
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-05032
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-30718
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-75515
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF,  IHC-P, WB
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32303
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00009527-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-32565
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-45631
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-81078
Species: Ha, Hu
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-84874
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-81414PEP
Species: Hu
Applications: AC

Publications for COG1 Protein (NBP1-81414PEP) (0)

There are no publications for COG1 Protein (NBP1-81414PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG1 Protein (NBP1-81414PEP) (0)

There are no reviews for COG1 Protein (NBP1-81414PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COG1 Protein (NBP1-81414PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COG1 Products

Array NBP1-81414PEP

Research Areas for COG1 Protein (NBP1-81414PEP)

Find related products by research area.

Blogs on COG1

There are no specific blogs for COG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COG1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COG1