CNIH3 Antibody - Azide and BSA Free

Western Blot: CNIH3 Antibody [H00149111-B01P] - Analysis of CNIH3 expression in transfected 293T cell line by CNIH3 polyclonal antibody. Lane 1: CNIH3 transfected lysate(17.6 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CNIH3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse CNIH3 Antibody - Azide and BSA Free (H00149111-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CNIH3 (NP_689708.1, 1 a.a. - 160 a.a.) full-length human protein. MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTLVSS
• Specificity: CNIH3 - cornichon homolog 3 (Drosophila),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CNIH3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CNIH3 Antibody - Azide and BSA Free

• CNIH-3
• cornichon homolog 3 (Drosophila)
• FLJ38993
• protein cornichon homolog 3

Background

Belonging to the cornichon family, cornichon homolog 3 (CNIH3) is a common ancestor of eukaryotes. Its main function is to regulate the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). CNIH3 can be found in a complex with GRIA1, GRIA2, GRIA3, GRIA4, CNIH2, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. It also regulates the activation, deactivation and desensitization of the cell membrane and synapses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for CNIH3 Antibody (H00149111-B01P). (Showing 1 - 1 of 1 FAQ).

1. Which secondary antibody, anti-mouse HRP or anti-rabbit-HRP, is used to detect H00149111-B01P antibody (for Western blot)?
   • For H00149111-B01P, you should use an anti-mouse IgG [HRP] secondary antibody for detection in western blot.

Bioinformatics

• Gene Symbol: CNIH3
• Entrez:
  • 149111(Human)
• Uniprot:
  • NP_689708.1(Human)