CMTM4 Antibody (1B9) - Azide and BSA Free

Western Blot: CMTM4 Antibody (1B9) [H00146223-M02] - Analysis of CMTM4 expression in transfected 293T cell line by CMTM4 monoclonal antibody (M02), clone 1B9.Lane 1: CMTM4 transfected lysate(25.8 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1B9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CMTM4 Antibody (1B9) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse CMTM4 Antibody (1B9) - Azide and BSA Free (H00146223-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CMTM4 (NP_848933, 173 a.a. ~ 234 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA
• Specificity: CMTM4 - CKLF-like MARVEL transmembrane domain containing 4 (1B9)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CMTM4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CMTM4 Antibody (1B9) - Azide and BSA Free

• chemokine-like factor super family 4
• chemokine-like factor superfamily 4
• Chemokine-like factor superfamily member 4
• CKLF-like MARVEL transmembrane domain containing 4
• CKLF-like MARVEL transmembrane domain-containing protein 4
• CKLFSF4
• CMTM4

Background

This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CMTM4
• Entrez:
  • 146223(Human)
• Uniprot:
  • NP_848933(Human)