CHCHD5 Antibody

Images

 
Western Blot: CHCHD5 Antibody [NBP1-86796] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CHCHD5 Antibody [NBP1-86796] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: CHCHD5 Antibody [NBP1-86796] - Staining of human testis shows strong cytoplasmic positivity in subsets of cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CHCHD5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MQAALEVTARYCGRELEQYGQCVAAKPESWQRDCHYLKMSIAQCTSSHPIIRQIRQACAQPFEAFEECLRQNEAAVGNCAEHMRRFLQCAEQVQPPRSPAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHCHD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CHCHD5 Protein (NBP1-86796PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CHCHD5 Antibody

  • C2orf9
  • chromosome 2 open reading frame 9
  • coiled-coil-helix-coiled-coil-helix domain containing 5
  • coiled-coil-helix-coiled-coil-helix domain-containing protein 5
  • FLJ39671
  • MGC11104

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83537
Species: Hu
Applications: IHC, IHC-P
NBP2-14477
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2050
Species: Hu
Applications: WB, IHC
NBP1-86796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CHCHD5 Antibody (NBP1-86796) (0)

There are no publications for CHCHD5 Antibody (NBP1-86796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHCHD5 Antibody (NBP1-86796) (0)

There are no reviews for CHCHD5 Antibody (NBP1-86796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CHCHD5 Antibody (NBP1-86796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CHCHD5 Products

Bioinformatics Tool for CHCHD5 Antibody (NBP1-86796)

Discover related pathways, diseases and genes to CHCHD5 Antibody (NBP1-86796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for CHCHD5 Antibody (NBP1-86796)

View related products by pathway.

Blogs on CHCHD5

There are no specific blogs for CHCHD5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CHCHD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHCHD5