Centaurin beta 2 Recombinant Protein Antigen

Images

 
There are currently no images for Centaurin beta 2 Protein (NBP1-84544PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Centaurin beta 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACAP2.

Source: E. coli

Amino Acid Sequence: LCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACAP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84544.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Centaurin beta 2 Recombinant Protein Antigen

  • Arf GAP with coiled coil, ANK repeat and PH domains 2
  • ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
  • centaurin, beta 2
  • Centaurin-beta-2
  • CENTB2centaurin-beta-2
  • CNT-B2
  • KIAA0041arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2

Background

Centaurin beta 1 and Centaurin beta 2 are recruited to platelet-derived growth factor-induced dorsal membrane ruffles in NIH 3T3 mouse fibroblasts, and overexpression inhibited ruffle formation. In vitro, Centaurin beta 1 and Centaurin beta 2 preferred ARF6 as substrate rather than ARF1 or ARF5, and the GAP activity of both Centaurins was dependent upon phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). The isolated PH domain of mouse Centaurin beta 2 exhibits moderate affinity for PtdIns(3,5)P2, but it does not bind any other phosphoinositides tested, including PtdIns(4,5)P2. Mutation of a highly conserved arginine in both Centaurins result in lack of ARF-GAP activity. Overexpression in HeLa cells of either Centaurin blocks the formation of ARF6-dependent protrusions. Both Centaurins are also recruited to peripheral, tubular membranes, where activation of ARF6 occurs and allows membrane recycling back to the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO
NBP3-48239
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP2-33806
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-00513
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-56581
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-20042
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP3-38499
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
AF6990
Species: Mu
Applications: ICC, WB
NBP2-33863
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88842
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84544PEP
Species: Hu
Applications: AC

Publications for Centaurin beta 2 Protein (NBP1-84544PEP) (0)

There are no publications for Centaurin beta 2 Protein (NBP1-84544PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Centaurin beta 2 Protein (NBP1-84544PEP) (0)

There are no reviews for Centaurin beta 2 Protein (NBP1-84544PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Centaurin beta 2 Protein (NBP1-84544PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Centaurin beta 2 Products

Research Areas for Centaurin beta 2 Protein (NBP1-84544PEP)

Find related products by research area.

Blogs on Centaurin beta 2

There are no specific blogs for Centaurin beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Centaurin beta 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAP2