CCDC72 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CCDC72 Antibody [NBP2-14594] - Staining of human cell line MCF7 shows localization to nucleus, nucleoli & nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC72 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSEGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEPKKLE
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC72 Protein (NBP2-14594PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC72 Antibody

  • HSPC016
  • TMA7 translational machinery associated 7 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-03626
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-80953
Species: Hu
Applications: IHC, IHC-P
NBP3-12550
Species: Hu
Applications: ICC/IF, IP, WB

Publications for CCDC72 Antibody (NBP2-14594) (0)

There are no publications for CCDC72 Antibody (NBP2-14594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC72 Antibody (NBP2-14594) (0)

There are no reviews for CCDC72 Antibody (NBP2-14594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CCDC72 Antibody (NBP2-14594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC72 Products

Array NBP2-14594

Pathways for CCDC72 Antibody (NBP2-14594)

View related products by pathway.

Blogs on CCDC72

There are no specific blogs for CCDC72, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC72 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMA7