Cbx2 Recombinant Protein Antigen

Images

 
There are currently no images for Cbx2 Protein (NBP2-47524PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cbx2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CBX2.

Source: E. coli

Amino Acid Sequence: KRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKESPTSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CBX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47524.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cbx2 Recombinant Protein Antigen

  • Cbx2
  • CDCA6
  • cell division cycle associated 6
  • chromobox homolog 2 (Drosophila Pc class)
  • chromobox homolog 2 (Pc class homolog, Drosophila)
  • chromobox homolog 2
  • chromobox protein homolog 2
  • M33
  • MGC10561
  • modifier 3
  • Pc class homolog
  • SRXY5

Background

Polycomb' genes in Drosophila maintain the repressed state of homeotic and other developmentally regulatedgenes (Wedeen et al., 1986 (PubMed 3081265); Kuziora and McGinnis, 1988 (PubMed 2903050)) by mediating changes inhigher-order chromatin structure (Paro and Hogness, 1991 (PubMed 1898775)). M33, a mouse homolog of polycomb, wasisolated by means of the structural similarity of its chromodomain (Pearce et al., 1992 (PubMed 1352241)). The fifthexon of M33 contains a region of homology shared by Drosophila and Xenopus. In Drosophila, its deletion results in theloss of polycomb function.(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NBP2-37370
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP3-41295
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00006045-M01
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP2-14900
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NB100-1240
Species: Hu
Applications: PEP-ELISA, WB
NBP2-29421
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1556
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF4885
Species: Mu
Applications: IP, WB
NBP1-49536
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-37371
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
PP-H7431-00
Species: Hu
Applications: WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF3075
Species: Hu
Applications: ICC, Simple Western, WB

Publications for Cbx2 Protein (NBP2-47524PEP) (0)

There are no publications for Cbx2 Protein (NBP2-47524PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cbx2 Protein (NBP2-47524PEP) (0)

There are no reviews for Cbx2 Protein (NBP2-47524PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cbx2 Protein (NBP2-47524PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cbx2 Products

Research Areas for Cbx2 Protein (NBP2-47524PEP)

Find related products by research area.

Blogs on Cbx2

There are no specific blogs for Cbx2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cbx2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX2