Recombinant Human Cbx2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cbx2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 374 - 463 of Human CBX2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HATATKGVPATNPAPGKGTGSGLIGASGATMPTDTSKSEKLASRAVAPPTPASKRDCVKGSATPSGQESRTAPGEARKAATLPEMSAGEE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CBX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cbx2 Protein

  • Cbx2
  • CDCA6
  • cell division cycle associated 6
  • chromobox homolog 2 (Drosophila Pc class)
  • chromobox homolog 2 (Pc class homolog, Drosophila)
  • chromobox homolog 2
  • chromobox protein homolog 2
  • M33
  • MGC10561
  • modifier 3
  • Pc class homolog
  • SRXY5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-33748
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37370
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00006045-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-14899
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
21650002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
AF4885
Species: Mu
Applications: WB, IP
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
PP-H7431-00
Species: Hu
Applications: WB
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC

Publications for Cbx2 Partial Recombinant Protein (H00084733-Q02) (0)

There are no publications for Cbx2 Partial Recombinant Protein (H00084733-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cbx2 Partial Recombinant Protein (H00084733-Q02) (0)

There are no reviews for Cbx2 Partial Recombinant Protein (H00084733-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cbx2 Partial Recombinant Protein (H00084733-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cbx2 Products

Bioinformatics Tool for Cbx2 Partial Recombinant Protein (H00084733-Q02)

Discover related pathways, diseases and genes to Cbx2 Partial Recombinant Protein (H00084733-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cbx2 Partial Recombinant Protein (H00084733-Q02)

Discover more about diseases related to Cbx2 Partial Recombinant Protein (H00084733-Q02).
 

Pathways for Cbx2 Partial Recombinant Protein (H00084733-Q02)

View related products by pathway.

PTMs for Cbx2 Partial Recombinant Protein (H00084733-Q02)

Learn more about PTMs related to Cbx2 Partial Recombinant Protein (H00084733-Q02).

Blogs on Cbx2

There are no specific blogs for Cbx2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
Cbx2 Antibody
NBP2-47524

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cbx2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CBX2
Entrez