Recombinant Human CATSPER1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CATSPER1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 681-780 of Human CATSPER1

Source: Wheat Germ

Amino Acid Sequence: GLEKAKQERAARIQEKLLEDSLTELRAAEPKEVASEGTMLKRLIEKKFGTMTEKQQELLFHYLQLVASVEQEQQKFRSQAAVIDEIVDTTFEAGEEDFRN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CATSPER1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CATSPER1 Protein

  • cation channel sperm-associated protein 1
  • cation channel, sperm associated 1
  • CatSper1
  • CATSPERsperm ion channel
  • hCatSper
  • MGC33335
  • MGC33368
  • sperm-associated cation channel 1

Background

Calcium ions play a primary role in the regulation of sperm motility. This gene belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-05819
Species: Hu
H00347732-Q01
Species: Hu
NBP1-91751
Species: Hu
Applications: IHC, IHC-P
NBP2-56179
Species: Hu
Applications: ICC/IF
NBP1-83220
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91968
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC, IHC-P, IF
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24516
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NB300-569
Species: Hu, Mu, Rt, Po, Am, Bv, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-15728
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CATSPER1 Partial Recombinant Protein (H00117144-Q01) (0)

There are no publications for CATSPER1 Partial Recombinant Protein (H00117144-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CATSPER1 Partial Recombinant Protein (H00117144-Q01) (0)

There are no reviews for CATSPER1 Partial Recombinant Protein (H00117144-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CATSPER1 Partial Recombinant Protein (H00117144-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array H00117144-Q01

Bioinformatics Tool for CATSPER1 Partial Recombinant Protein (H00117144-Q01)

Discover related pathways, diseases and genes to CATSPER1 Partial Recombinant Protein (H00117144-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CATSPER1 Partial Recombinant Protein (H00117144-Q01)

Discover more about diseases related to CATSPER1 Partial Recombinant Protein (H00117144-Q01).
 

Pathways for CATSPER1 Partial Recombinant Protein (H00117144-Q01)

View related products by pathway.

PTMs for CATSPER1 Partial Recombinant Protein (H00117144-Q01)

Learn more about PTMs related to CATSPER1 Partial Recombinant Protein (H00117144-Q01).

Blogs on CATSPER1

There are no specific blogs for CATSPER1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CATSPER1 RNAi
H00117144-R01-20nmol
PGRMC1 Antibody
NBP1-83220

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CATSPER1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CATSPER1