We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen

Images

 
There are currently no images for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Carbohydrate Sulfotransferase 5/CHST5

Source: E. coli

Amino Acid Sequence: YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHST5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17221.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen

  • carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
  • Carbohydrate Sulfotransferase 5
  • CHST5
  • GlcNAc6ST3
  • gn6st-3
  • GST4-alpha
  • hIGn6ST
  • I-GlcNAc6ST

Background

CHST5 is a gene that codes for a protein with two isoforms, measuring 411 and 417 amino acids in length, with weights of approximately 46 and 47 kDa respectively. CHST5 functions as a sulfotransferase that does not transfer sulfate to longer carbohydrate structures nor does it have activity toward keratin. Current research is being done of several diseases and disorders related to this gene including corneal dystrophy, adenocarcinoma, esophagitis, cholesterol, immunodeficiency, and hepatitis. CHST5 has also been shown to have interactions with CHST1, KERA, LUM, ST#GAL3, and FMOD in pathways such as the metabolism, Maroteaux-Lamy syndrome, and Hunter syndrome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5357
Species: Hu
Applications: IP, Neut, WB
NBP1-59944
Species: Hu
Applications: WB
5326-ST
Species: Hu
Applications: EnzAct
BBA24
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
NBP2-24787
Species: Ca, Hu, Mu
Applications: DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DY413
Species: Mu
Applications: ELISA
DTFF30
Species: Hu
Applications: ELISA
AF5316
Species: Hu
Applications: WB
NBP3-46271
Species: Hu, Mu, Rt
Applications: ELISA, WB
H00002953-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
H00002946-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15897
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7458
Species: Hu
Applications: IHC, WB
NBP3-17221PEP
Species: Hu
Applications: AC

Publications for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP) (0)

There are no publications for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP) (0)

There are no reviews for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Carbohydrate Sulfotransferase 5/CHST5 Products

Research Areas for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP)

Find related products by research area.

Blogs on Carbohydrate Sulfotransferase 5/CHST5

There are no specific blogs for Carbohydrate Sulfotransferase 5/CHST5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHST5