Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Carbohydrate Sulfotransferase 5/CHST5 Source: E. coli
Amino Acid Sequence: YRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CHST5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17221. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen
Background
CHST5 is a gene that codes for a protein with two isoforms, measuring 411 and 417 amino acids in length, with weights of approximately 46 and 47 kDa respectively. CHST5 functions as a sulfotransferase that does not transfer sulfate to longer carbohydrate structures nor does it have activity toward keratin. Current research is being done of several diseases and disorders related to this gene including corneal dystrophy, adenocarcinoma, esophagitis, cholesterol, immunodeficiency, and hepatitis. CHST5 has also been shown to have interactions with CHST1, KERA, LUM, ST#GAL3, and FMOD in pathways such as the metabolism, Maroteaux-Lamy syndrome, and Hunter syndrome pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow
Species: Ca, Hu, Mu
Applications: DB, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Publications for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP) (0)
There are no publications for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP) (0)
There are no reviews for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP) (0)
Additional Carbohydrate Sulfotransferase 5/CHST5 Products
Research Areas for Carbohydrate Sulfotransferase 5/CHST5 Recombinant Protein Antigen (NBP3-17221PEP)
Find related products by research area.
|
Blogs on Carbohydrate Sulfotransferase 5/CHST5