C2CD2 Antibody

Immunocytochemistry/Immunofluorescence: C2CD2 Antibody [NBP1-88278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: C2CD2 Antibody [NBP1-88278] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: C2CD2 Antibody [NBP1-88278] - Staining of human adrenal gland shows moderate membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: C2CD2 Antibody [NBP1-88278] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: C2CD2 Antibody [NBP1-88278] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

C2CD2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C2CD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  C2CD2 Protein (NBP1-88278PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C2CD2 Antibody

• C2 calcium-dependent domain containing 2

Background

C2CD2 (C2 domain-containing protein 2) is a secreted 696 amino acid protein. It binds ELAVL1 and UBC and contains a C2 domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C2CD2