C17orf80 Antibody

Images

 
Western Blot: C17orf80 Antibody [NBP1-83637] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: C17orf80 Antibody [NBP1-83637] - Staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: C17orf80 Antibody [NBP1-83637] - Staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C17orf80 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGASLLVGSIEPSLSNQDRKYSSTLPNDVQTTSGDLKLDKIDPQRQELLVKLLDVPTGDCHISPKNVSDGVKRVRTLLSNERDSKGRDHLSGVPTDVTVTETPEKNTESLILSLKMSSLGKIQVM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C17ORF80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C17orf80 Protein (NBP1-83637PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C17orf80 Antibody

  • Cell migration-inducing gene 3 protein
  • chromosome 17 open reading frame 80
  • FLJ20721
  • HLC-8
  • HLC-8migration-inducing protein 3
  • Human lung cancer oncogene 8 protein
  • lung cancer-related protein 8
  • MIG3
  • SPEP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47745
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83637
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for C17orf80 Antibody (NBP1-83637) (0)

There are no publications for C17orf80 Antibody (NBP1-83637).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C17orf80 Antibody (NBP1-83637) (0)

There are no reviews for C17orf80 Antibody (NBP1-83637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C17orf80 Antibody (NBP1-83637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C17orf80 Products

Bioinformatics Tool for C17orf80 Antibody (NBP1-83637)

Discover related pathways, diseases and genes to C17orf80 Antibody (NBP1-83637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C17orf80

There are no specific blogs for C17orf80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C17orf80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C17ORF80