C15orf41 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C15orf41 Antibody [NBP2-32583] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: C15orf41 Antibody [NBP2-32583] - Staining of human urinary bladder shows moderate nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C15orf41 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHHTSEAIESYYQRYLNGVVKNGAAPVLLDLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C15orf41
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C15orf41 Protein (NBP2-32583PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C15orf41 Antibody

  • Chromosome 15 Open Reading Frame 41
  • HH114
  • Protein HH114
  • Uncharacterized Protein C15orf41

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-55057
Species: Hu
Applications: ICC/IF
AF5067
Species: Hu
Applications: WB
NBP2-32583
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for C15orf41 Antibody (NBP2-32583) (0)

There are no publications for C15orf41 Antibody (NBP2-32583).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C15orf41 Antibody (NBP2-32583) (0)

There are no reviews for C15orf41 Antibody (NBP2-32583). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C15orf41 Antibody (NBP2-32583) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C15orf41 Products

C15orf41 NBP2-32583

Bioinformatics Tool for C15orf41 Antibody (NBP2-32583)

Discover related pathways, diseases and genes to C15orf41 Antibody (NBP2-32583). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C15orf41

There are no specific blogs for C15orf41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C15orf41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C15orf41