BTBD1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry: BTBD1 Antibody [NBP2-38109] - Staining of human heart muscle shows moderate positivity in intercalated discs.

Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining in human skeletal muscle and pancreas tissues using anti-BTBD1 antibody. Corresponding BTBD1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BTBD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BTBD1 Antibody - BSA Free (NBP2-38109) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSLGPLLPLQREPLYNWQATKASLKERFAFL
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTBD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BTBD1 Protein (NBP2-38109PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BTBD1 Antibody - BSA Free

• BTB (POZ) domain containing 1
• BTB domain containing 1
• BTB/POZ domain-containing protein 1
• C15orf1
• HCV NS5A-transactivated protein 8
• Hepatitis C virus NS5A-transactivated protein 8
• NS5ATP8

Background

The C-terminus of the protein encoded by this gene binds topoisomerase I. The N-terminus contains a proline-rich region and a BTB/POZ domain (broad-complex, Tramtrack and bric a brac/Pox virus and Zinc finger), both of which are typically involved in protein-protein interactions. Subcellularly, the protein localizes to cytoplasmic bodies. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BTBD1
• Uniprot:
  • Q9H0C5(Human)