![Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize/BTBD1-Antibody-Immunohistochemistry-Paraffin-NBP2-38109-img0003.jpg "Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining of human skeletal muscle shows high expression.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSLGPLLPLQREPLYNWQATKASLKERFAFL |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BTBD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot NAC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NAC1_AF8375_Western_Blot_15897.jpg)
![Immunohistochemistry NAC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NAC1_AF8375_Immunohistochemistry_15904.jpg)
![Knockout Validated NAC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/NAC1_AF8375_Knockout_Validated_22990.jpg)
![Western Blot TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/TRIM_AF4708_Western_Blot_5528.jpg)
![Intracellular Staining by Flow Cytometry TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/TRIM_AF4708_Flow_Cytometry_8261.jpg)
![Simple Western TRIM Antibody [Unconjugated]](https://images.novusbio.com/images2/af4708_human-trim-affinity-purified-polyclonal-ab-simple-western-911202293520.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for BTBD1 Antibody (NBP2-38109)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: BTBD1 Antibody [NBP2-38109] - Staining of human heart muscle shows moderate positivity in intercalated discs.](http://images.novusbio.com/fullsize/BTBD1-Antibody-Immunohistochemistry-NBP2-38109-img0001.jpg "Immunohistochemistry: BTBD1 Antibody [NBP2-38109] - Staining of human heart muscle shows moderate positivity in intercalated discs.")
![Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/BTBD1-Antibody-Immunohistochemistry-Paraffin-NBP2-38109-img0002.jpg "Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining in human skeletal muscle and pancreas tissues using anti-BTBD1 antibody. Corresponding BTBD1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BTBD1-Antibody-Immunohistochemistry-Paraffin-NBP2-38109-img0004.jpg "Immunohistochemistry-Paraffin: BTBD1 Antibody [NBP2-38109] - Staining in human skeletal muscle and pancreas tissues using anti-BTBD1 antibody. Corresponding BTBD1 RNA-seq data are presented for the same tissues.")
![Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Western_Blot_16698.jpg)
![Immunohistochemistry IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images2/IGFBPrp1_AF1334_Immunohistochemistry_17204.jpg)
![Western Blot IGFBP-rp1/IGFBP-7 Antibody [Unconjugated]](https://images.novusbio.com/images/af1334_human-igfbp-rp1-igfbp-7-affinity-purified-polyclonal-ab-western-blot-121220258461021.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")