ASB7 Antibody - BSA Free

Western Blot: ASB7 Antibody [NBP1-57599] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ASB7 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ASB7 (ankyrin repeat and SOCS box-containing 7) The peptide sequence was selected from the middle region of ASB7)(50ug). Peptide sequence QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASB7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ASB7 Antibody - BSA Free

• ankyrin repeat and SOCS box containing 7
• ankyrin repeat and SOCS box protein 7
• ankyrin repeat and SOCS box-containing 7
• ASB-7
• FLJ22551
• FLJ25192

Background

The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contains a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. In this way, SOCS box containing proteins may regulate protein turnover by targeting proteins for polyubiquination and, therefore, for proteasome-mediated degradation. Two alternative transcripts encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ASB7 Antibody (NBP1-57599)(1)

Publication using NBP1-57599

• AnaSa VV, Manickam M, Talwar P, Ravanan P. Identification of ASB7 as ER stress responsive gene through a genome wide in silico screening for genes with ERSE PLoS ONE 2018-04-09 [PMID: 29630609] (WB, Human)

Bioinformatics

• Gene Symbol: ASB7
• Uniprot:
  • Q9H672(Human)