Home » ANKRD32 » ANKRD32 Proteins » ANKRD32 Recombinant Protein Antigen

ANKRD32 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ANKRD32 Protein (NBP1-88358PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ANKRD32 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANKRD32.

Source: E.coli

Amino Acid Sequence: EYAKESKAMAIKTDVDVVEIKNTLRKHIYRAQAVRYNCIRIDKQPVYNVEVKNAEFPRGVLNLIESLIEGHFFKEAIEELSTLQAHYIPPVC
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANKRD32
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88358.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ANKRD32 Recombinant Protein Antigen

  • ankyrin repeat domain 32
  • ankyrin repeat domain-containing protein 32
  • BRCT domain containing 1
  • BRCT domain-containing protein 1
  • BRCTD1
  • BRCTx
  • DKFZp564C0469
  • DKFZp761C121

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RAD18 Antibody
(3H7)
H00056852-M01
Immunocytochemistry/Immunofluorescence: RAD18 Antibody (3H7) [H00056852-M01] - Analysis of monoclonal antibody to RAD18 on HeLa cell. Antibody concentration 25 ug/ml.
Immunohistochemistry-Paraffin: RAD18 Antibody (3H7) [H00056852-M01] - Analysis of monoclonal antibody to RAD18 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.5 ug/ml.
Western Blot: RAD18 Antibody (3H7) [H00056852-M01] - Analysis of RAD18 over-expressed 293 cell line, cotransfected with RAD18 Validated Chimera RNAi ( Cat # H00056852-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD18 monoclonal antibody (M01), clone 3H7 (Cat # H00056852-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(2 Reviews)
(13 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
Elf4/MEF Antibody
NBP2-33286
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining in human stomach and cerebral cortex tissues using anti-ELF4 antibody. Corresponding ELF4 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
ALDH9A1 Antibody
NBP1-89150
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in human cell line TD47D.
Western Blot: ALDH9A1 Antibody [NBP1-89150] - Analysis in rat cell line NBT-II.
Immunohistochemistry-Paraffin: ALDH9A1 Antibody [NBP1-89150] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
(3 Publications)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
CD8 Antibody
(53-6.7)
NBP1-49045
Immunohistochemistry-Paraffin: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - CD8 alpha expression in mouse spleen tissue using anti-CD8 alpha antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of bone marrow tissue by single and multiple staining.
Immunohistochemistry-Frozen: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of mosue spleen sections. CD8+ lymphocytes are marked by brown labeling of the cell surface.
(3 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
MEFV Antibody
NBP2-17262
Western Blot: MEFV Antibody [NBP2-17262] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with MEFV antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: MEFV Antibody [NBP2-17262] - Whole cell extract (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with MEFV antibody [N3C1], Internal diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: MEFV Antibody [NBP2-17262] - Immunofluorescence analysis of paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Species: Hu
Applications: ICC/IF, WB
CD4 Antibody
NBP1-19371
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
Flow Cytometry: CD4 Antibody [NBP1-19371] - An intracellular stain was performed on Jurkat cells with CD4 Antibody NBP1-19371R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
(9 Reviews)
(35 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ILT6/CD85e/LILRA3
Antibody (2E9)
H00011026-M01
Western Blot: ILT6/CD85e/LILRA3 Antibody (2E9) [H00011026-M01] - Analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.Lane 1: LILRA3 transfected lysate(50.485 KDa).Lane 2: Non-transfected lysate.
(5 Publications)
Species: Hu
Applications: ELISA, WB
Dihydrolipoamide
Dehydrogenase/DLD Ant ...
NBP1-31302
Immunocytochemistry/Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: DLD protein stained by DLD antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Sample(30 ug of whole cell lysate) A:293T 10% SDS PAGE, antibody diluted at 1:1000.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-31302] - Wild-type (WT) and DLD knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with DLD antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: PCNA Antibody (PC10) [NB500-106] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: PCNA Antibody (PC10) [NB500-106] - An intracellular stain was performed on HepG2 cells with PCNA Antibody (PC10) NB500-106G (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 488.
(5 Reviews)
(36 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
BRCA1 Antibody
(6B4)
NB100-404
Chromatin Immunoprecipitation: BRCA1 Antibody (6B4) [NB100-404] - The 6B4 and 17F8 mixture (3 microgram each), or normal mouse IgG (6 microgram) were incubated with HeLa chromatin extract (100 microgram each) in the ChIP assay. Enrichment of genomic DNA on a BRCA1 target gene promoter (HMGA2) was validated by a Q-PCR assay.
Immunohistochemistry: BRCA1 Antibody (6B4) [NB100-404]
Knockdown Validated: BRCA1 Antibody (6B4) [NB100-404] - DAG-induced DNA damage is repaired by homologous recombination. A549 cells were transfected with either negative control (C) or three BRCA1-targeting siRNAs (B1, siBRCA1-2; B2, siBRCA1-15; or B3, siBRCA1-17) for 24 h. Cells were then seeded in 96-well culture plates and treated with different concentrations of VAL-083 (0, 100 nM, 500 nM, 1 uM, 1.5 uM, 2.5 uM, 5 uM, 10 uM, 25 uM, 50 uM, 100 uM, and 200 uM) for 5 days. Following the treatment, crystal violet assay was performed to detect the absorbance at 560 nm wavelength. Cell lysates from the control or BRCA1-knockdown cells were analyzed by western blot with antibody against BRCA1, and GAPDH was used as a loading control. Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/s41419-018-1069-9) licensed under a CC-BY licence.
(6 Publications)
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO, WB

Publications for ANKRD32 Protein (NBP1-88358PEP) (0)

There are no publications for ANKRD32 Protein (NBP1-88358PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD32 Protein (NBP1-88358PEP) (0)

There are no reviews for ANKRD32 Protein (NBP1-88358PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ANKRD32 Protein (NBP1-88358PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional ANKRD32 Products

Array NBP1-88358PEP

Bioinformatics Tool for ANKRD32 Protein (NBP1-88358PEP)

Discover related pathways, diseases and genes to ANKRD32 Protein (NBP1-88358PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKRD32

There are no specific blogs for ANKRD32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
PCNA Antibody (PC10)
NB500-106
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ANKRD32 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ANKRD32