ALKBH6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALKBH6 Antibody [NBP2-57047] - Staining of human cell line A549 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALKBH6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALKBH6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ALKBH6 Recombinant Protein Antigen (NBP2-57047PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ALKBH6 Antibody

  • ABH6
  • AlkB Homolog 6
  • AlkB, Alkylation Repair Homolog 6 (E. Coli)
  • AlkB, Alkylation Repair Homolog 6
  • Alkylated DNA Repair Protein AlkB Homolog 6
  • Alkylation Repair Homolog 6
  • Alpha-Ketoglutarate-Dependent Dioxygenase AlkB Homolog 6
  • EC 1.14.11
  • Probable Alpha-Ketoglutarate-Dependent Dioxygenase ABH6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008846-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76276
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-84274
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83711
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38450
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-57047
Species: Hu
Applications: ICC/IF

Publications for ALKBH6 Antibody (NBP2-57047) (0)

There are no publications for ALKBH6 Antibody (NBP2-57047).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALKBH6 Antibody (NBP2-57047) (0)

There are no reviews for ALKBH6 Antibody (NBP2-57047). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALKBH6 Antibody (NBP2-57047) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ALKBH6 Products

Bioinformatics Tool for ALKBH6 Antibody (NBP2-57047)

Discover related pathways, diseases and genes to ALKBH6 Antibody (NBP2-57047). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ALKBH6

There are no specific blogs for ALKBH6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALKBH6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALKBH6