![Western Blot: C9orf98 Antibody (3B8) [H00158067-M01] - Analysis of C9orf98 over-expressed 293 cell line, cotransfected with C9orf98 Validated Chimera RNAi ( Cat # H00158067-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf98 monoclonal antibody (M01), clone 3B8 (Cat # H00158067-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/C9orf98-Antibody-3B8-Western-Blot-H00158067-M01-img0003.jpg "Western Blot: C9orf98 Antibody (3B8) [H00158067-M01] - Analysis of C9orf98 over-expressed 293 cell line, cotransfected with C9orf98 Validated Chimera RNAi ( Cat # H00158067-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf98 monoclonal antibody (M01), clone 3B8 (Cat # H00158067-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, KD |
| Clone | 3B8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | C9orf98 (NP_689785, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP |
| Specificity | C9orf98 - chromosome 9 open reading frame 98 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | AK8 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: C9orf98 Antibody (3B8) [H00158067-M01] - Analysis of C9orf98 expression in transfected 293T cell line by C9orf98 monoclonal antibody (M01), clone 3B8.Lane 1: C9orf98 transfected lysate(54.9 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/C9orf98-Antibody-3B8-Western-Blot-H00158067-M01-img0004.jpg "Western Blot: C9orf98 Antibody (3B8) [H00158067-M01] - Analysis of C9orf98 expression in transfected 293T cell line by C9orf98 monoclonal antibody (M01), clone 3B8.Lane 1: C9orf98 transfected lysate(54.9 KDa).Lane 2: Non-transfected lysate.")
![Immunohistochemistry Frizzled-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Frizzled-3_AF1001_Immunohistochemistry_9912.jpg)
![Frizzled-9 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Frizzled-9 Antibody [Unconjugated]")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")