Adenylate Cyclase 5 Recombinant Protein Antigen

Images

 
There are currently no images for Adenylate Cyclase 5 Recombinant Protein Antigen (NBP2-57976PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Adenylate Cyclase 5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Adenylate Cyclase 5.

Source: E. coli

Amino Acid Sequence: FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADCY5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57976.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Adenylate Cyclase 5 Recombinant Protein Antigen

  • AC5
  • ADCY5
  • Adenylate Cyclase 5
  • adenylate cyclase type 5
  • Adenylate cyclase type V
  • Adenylyl cyclase 5
  • ATP pyrophosphate-lyase 5
  • EC 4.6.1.1

Background

ADCY5, also known as Adenylate cyclase type 5, consists of a 1,261 amino acid long isoform that is 139 kDa and a shorter 911 amino acid isoform that is 103 kDa, and is involved in the encoding of a membrane-bound enzyme. This protein has also been shown to have interactions with ADCY2, GNAS, PRKACA, GNAI1, and PRKCA in the Signaling by FGFR, PKA activation in glucagon signaling, DAG and IP3 signaling, Regulation of Water Balance by Renal Aquaporins, and Opioid Signalling pathway. Disease research is currently being studied with relation to ADCY5 and pancreatitis, leukemia, precocious puberty, and immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-12233
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-12215
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-12505
Species: Mu, Rb, Rt
Applications: ELISA, IP, WB
NBP3-12506
Species: Hu, Mu, Rt
Applications: ELISA, WB
H00010141-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-92683
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP3-12217
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP3-12214
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP3-29606
Species: Hu, Mu
Applications: IHC, IP, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-57976PEP
Species: Hu
Applications: AC

Publications for Adenylate Cyclase 5 Recombinant Protein Antigen (NBP2-57976PEP) (0)

There are no publications for Adenylate Cyclase 5 Recombinant Protein Antigen (NBP2-57976PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Cyclase 5 Recombinant Protein Antigen (NBP2-57976PEP) (0)

There are no reviews for Adenylate Cyclase 5 Recombinant Protein Antigen (NBP2-57976PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Adenylate Cyclase 5 Recombinant Protein Antigen (NBP2-57976PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenylate Cyclase 5 Products

Research Areas for Adenylate Cyclase 5 Recombinant Protein Antigen (NBP2-57976PEP)

Find related products by research area.

Blogs on Adenylate Cyclase 5

There are no specific blogs for Adenylate Cyclase 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Adenylate Cyclase 5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADCY5