ADCY4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ADCY4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADCY4.
  
  

  Source: E. coli

  Amino Acid Sequence: FAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ADCY4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37920.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADCY4 Recombinant Protein Antigen

• AC4
• ADCY4
• Adenylate Cyclase 4
• adenylate cyclase type 4
• Adenylate cyclase type IV
• Adenylyl cyclase 4
• ATP pyrophosphate-lyase 4
• EC 4.6.1
• EC 4.6.1.1

Background

Adenylyl cyclases function to convert ATP to cyclic AMP in response to activation by a variety of hormones, neurotransmitters and other regulatory molecules. Cyclic AMP, in turn, activates several other target molecules to control a broad range of diverse phenomena such as metabolism, gene transcription and memory. Adenylyl cyclases respond to receptor-initiated signals, mediated by the Gs and Gi heterotrimeric G proteins. The binding of an agonist to a Gs-coupled receptor catalyzes the exchange of GDP (bound to Galpha s) for GTP, the dissociation of GTP-Galpha s from Gbetagamma and Galpha s-mediated activation of adenylyl cyclase. Adenylyl cyclase IV (AC IV) and IX mRNA are expressed in all kidney nephron segments. AC IV exhibits moderate staining in type II and type IV fibrocytes in rat cochlea and immunoreactivity is also observed in type I fibrocytes. Activation of the D2 dopaminergic and m4 muscarine receptors inhibits the activity of adenylyl cyclase isozymes I, V, VI and VIII, whereas type II, IV and VII are stimulated and type III is not affected.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ADCY4