ADAM30 Antibody (NBP1-69319)


Western Blot: ADAM30 Antibody [NBP1-69319] - This Anti-ADAM30 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 5ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ADAM30 Antibody Summary

Synthetic peptides corresponding to ADAM30(ADAM metallopeptidase domain 30) The peptide sequence was selected from the N terminal of ADAM30. Peptide sequence RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ADAM30 and was validated on Western blot.
Theoretical MW
66 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADAM30 Antibody

  • a disintegrin and metalloproteinase domain 30
  • ADAM 30
  • ADAM metallopeptidase domain 30
  • disintegrin and metalloproteinase domain-containing protein 30
  • EC 3.4.24.-
  • svph4


ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-terminal repeats.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
Species: Hu
Applications: WB

Publications for ADAM30 Antibody (NBP1-69319) (0)

There are no publications for ADAM30 Antibody (NBP1-69319).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM30 Antibody (NBP1-69319) (0)

There are no reviews for ADAM30 Antibody (NBP1-69319). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM30 Antibody (NBP1-69319) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ADAM30 Products

Related Products by Gene

Bioinformatics Tool for ADAM30 Antibody (NBP1-69319)

Discover related pathways, diseases and genes to ADAM30 Antibody (NBP1-69319). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM30 Antibody (NBP1-69319)

Discover more about diseases related to ADAM30 Antibody (NBP1-69319).

Blogs on ADAM30

There are no specific blogs for ADAM30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADAM30 Antibody and receive a gift card or discount.


Gene Symbol ADAM30