ABHD16B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ABHD16B Antibody [NBP2-31761] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ABHD16B Antibody [NBP2-31761] - Staining of human small intestine shows strong cytoplasmic positivity in enteroendocrine cells in glands.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABHD16B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRSYRARCEEELEGEEALGPHGPAFPWLVGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABHD16B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABHD16B Protein (NBP2-31761PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABHD16B Antibody

  • abhydrolase domain containing 16B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-06677
Species: Hu
NBP1-79193
Species: Hu
Applications: WB
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF2200
Species: Hu
Applications: WB, IP
NBP2-56316
Species: Hu
Applications: IHC, IHC-P
NBP2-24521
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC-P, ICC
NBP2-05207
Species: Hu
AF5016
Species: Hu
Applications: WB
NB100-74357
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31761
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABHD16B Antibody (NBP2-31761) (0)

There are no publications for ABHD16B Antibody (NBP2-31761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABHD16B Antibody (NBP2-31761) (0)

There are no reviews for ABHD16B Antibody (NBP2-31761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABHD16B Antibody (NBP2-31761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABHD16B Products

ABHD16B NBP2-31761

Bioinformatics Tool for ABHD16B Antibody (NBP2-31761)

Discover related pathways, diseases and genes to ABHD16B Antibody (NBP2-31761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABHD16B Antibody (NBP2-31761)

Discover more about diseases related to ABHD16B Antibody (NBP2-31761).
 

Pathways for ABHD16B Antibody (NBP2-31761)

View related products by pathway.

PTMs for ABHD16B Antibody (NBP2-31761)

Learn more about PTMs related to ABHD16B Antibody (NBP2-31761).

Blogs on ABHD16B

There are no specific blogs for ABHD16B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABHD16B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD16B
Uniprot