ABHD15 Antibody

Images

 
Western Blot: ABHD15 Antibody [NBP2-82547] - WB Suggested Anti-ABHD15 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 721_B cell lysate

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABHD15 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ABHD15. Peptide sequence: QTLCHFVLPVAPGPELAREYLQLADDGLVALDWVVGPCVRGRRITSAGGL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ABHD15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABHD15 Antibody

  • abhydrolase domain containing 15
  • abhydrolase domain-containing protein 15
  • UNQ6510/PRO21435

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP1-43333
Species: Mu
Applications: WB
NBP2-75646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19160
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81855
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO

Publications for ABHD15 Antibody (NBP2-82547) (0)

There are no publications for ABHD15 Antibody (NBP2-82547).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABHD15 Antibody (NBP2-82547) (0)

There are no reviews for ABHD15 Antibody (NBP2-82547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABHD15 Antibody (NBP2-82547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ABHD15 Products

Bioinformatics Tool for ABHD15 Antibody (NBP2-82547)

Discover related pathways, diseases and genes to ABHD15 Antibody (NBP2-82547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABHD15 Antibody (NBP2-82547)

Discover more about diseases related to ABHD15 Antibody (NBP2-82547).

PTMs for ABHD15 Antibody (NBP2-82547)

Learn more about PTMs related to ABHD15 Antibody (NBP2-82547).

Blogs on ABHD15

There are no specific blogs for ABHD15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABHD15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD15