ZNF93 Antibody

Images

 
Western Blot: ZNF93 Antibody [NBP1-79260] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
Western Blot: ZNF93 Antibody [NBP1-79260] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Western Blot: ZNF93 Antibody [NBP1-79260] - Human MCF7, Antibody Dilution: 1.0 ug/ml ZNF93 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF93 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human ZNF93The immunogen for this antibody is ZNF93. Peptide sequence FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF93
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNF93 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF93 Antibody

  • HPF34
  • HTF34
  • TF34
  • zinc finger protein 505
  • zinc finger protein 93
  • zinc finger protein HTF34
  • ZNF505

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55686
Species: Hu
Applications: ICC/IF
H00005555-P01
Species: Hu
NBP1-79358
Species: Hu
Applications: WB
NBP2-13577
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
H00007594-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ZNF93 Antibody (NBP1-79260) (0)

There are no publications for ZNF93 Antibody (NBP1-79260).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF93 Antibody (NBP1-79260) (0)

There are no reviews for ZNF93 Antibody (NBP1-79260). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF93 Antibody (NBP1-79260) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-79260

Bioinformatics Tool for ZNF93 Antibody (NBP1-79260)

Discover related pathways, diseases and genes to ZNF93 Antibody (NBP1-79260). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF93 Antibody (NBP1-79260)

Discover more about diseases related to ZNF93 Antibody (NBP1-79260).
 

Pathways for ZNF93 Antibody (NBP1-79260)

View related products by pathway.

Blogs on ZNF93

There are no specific blogs for ZNF93, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF93 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF93
Uniprot