ZNF75A Antibody (NBP1-82020)

Images

 
Western Blot: ZNF75A Antibody [NBP1-82020] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver ...read more
Immunocytochemistry/ Immunofluorescence: ZNF75A Antibody [NBP1-82020] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: ZNF75A Antibody [NBP1-82020] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF75A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQELLKLM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF75A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
ZNF75A Protein (NBP1-82020PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF75A Antibody

  • FLJ31529
  • MGC59959
  • zinc finger protein 75a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88035
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
NBP1-82020
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZNF75A Antibody (NBP1-82020) (0)

There are no publications for ZNF75A Antibody (NBP1-82020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF75A Antibody (NBP1-82020) (0)

There are no reviews for ZNF75A Antibody (NBP1-82020). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF75A Antibody (NBP1-82020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF75A Products

Related Products by Gene

Bioinformatics Tool for ZNF75A Antibody (NBP1-82020)

Discover related pathways, diseases and genes to ZNF75A Antibody (NBP1-82020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF75A

There are no specific blogs for ZNF75A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF75A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF75A

Customers Who Bought This Also Bought