![Immunohistochemistry-Paraffin: ZNF562 Antibody [NBP3-04480] - Paraffin-embedded mouse liver using ZNF562 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/ZNF562-Antibody-Immunohistochemistry-Paraffin-NBP3-04480-img0003.jpg "Immunohistochemistry-Paraffin: ZNF562 Antibody [NBP3-04480] - Paraffin-embedded mouse liver using ZNF562 antibody at dilution of 1:100 (40x lens).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit ZNF562 Antibody - Azide and BSA Free (NBP3-04480) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ZNF562 (NP_001123503.1). MSAFDMSHGFFPREPICPFEEKTKIGTMVEDHRSNSYQDSVTFDDVAVEFTPEEWALLDTTQKYLYRDVMLENYMNLASVDFFFCLTSEWEIQPRTKRSSLQQGFLKNQIFTGIQMQTRSYSGWKLCENCGEVFSEQFCLKTHMRAQNGGNTFEGNCYGKDSISVHKEASIGQELSKFNP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF562 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF562 |
![Immunohistochemistry-Paraffin: ZNF562 Antibody [NBP3-04480] - Paraffin-embedded human lung cancer using ZNF562 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/ZNF562-Antibody-Immunohistochemistry-Paraffin-NBP3-04480-img0001.jpg "Immunohistochemistry-Paraffin: ZNF562 Antibody [NBP3-04480] - Paraffin-embedded human lung cancer using ZNF562 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: ZNF562 Antibody [NBP3-04480] - Paraffin-embedded human gastric cancer using ZNF562 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/ZNF562-Antibody-Immunohistochemistry-Paraffin-NBP3-04480-img0002.jpg "Immunohistochemistry-Paraffin: ZNF562 Antibody [NBP3-04480] - Paraffin-embedded human gastric cancer using ZNF562 antibody at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: ZNF562 Antibody [NBP3-04480] - Paraffin-embedded mouse kidney using ZNF562 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/ZNF562-Antibody-Immunohistochemistry-Paraffin-NBP3-04480-img0004.jpg "Immunohistochemistry-Paraffin: ZNF562 Antibody [NBP3-04480] - Paraffin-embedded mouse kidney using ZNF562 antibody at dilution of 1:100 (40x lens).")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")