![Western Blot: ZNF483 Antibody [NBP2-88601] - WB Suggested Anti-ZNF483 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: MCF7 cell lysate](http://images.novusbio.com/fullsize2/ZNF483-Antibody-Western-Blot-NBP2-88601-img0001.jpg "Western Blot: ZNF483 Antibody [NBP2-88601] - WB Suggested Anti-ZNF483 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: MCF7 cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF483. Peptide sequence: EAILRGNAADAESFRQRFRWFCYSEVAGPRKALSQLWELCNQWLRPDIHT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZNF483 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot: MCM8 Antibody [NBP2-55276] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.](http://images.novusbio.com/images2/MCM8-Antibody-Western-Blot-NBP2-55276-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: MCM8 Antibody [NBP2-55276] - Staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/images2/MCM8-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55276-img0003.jpg)
![Western Blot: MCM8 Antibody [NBP2-55276] - Analysis in human cell line U-138MG.](http://images.novusbio.com/images2/MCM8-Antibody-Western-Blot-NBP2-55276-img0004.jpg)
![Western Blot: CENPW Antibody [NBP2-81905] - Western blot analysis of CENPW in HeLa cell lysate lysate with CENPW antibody at (A) 0.5 and (B) 1 ug/mL.](http://images.novusbio.com/images2/CENPW-Antibody-Western-Blot-NBP2-81905-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: BRSK1 Antibody [NBP1-76778] - Immunofluorescence of BRSK1 in Human Brain cells with BRSK1 antibody at 20 ug/mL.](http://images.novusbio.com/images2/BRSK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-76778-img0003.jpg)
![Immunohistochemistry-Paraffin: BRSK1 Antibody [NBP1-76778] - Immunohistochemistry of BRSK1 in human brain tissue with BRSK1 antibody at 2.5 ug/ml.](http://images.novusbio.com/images2/BRSK1-Antibody-Immunohistochemistry-Paraffin-NBP1-76778-img0001.jpg)
![Western Blot: BRSK1 Antibody [NBP1-76778] - Human brain tissue lysate with BRSK1 antibody at (A) 0.5 and (B) 1 ug/ml.](http://images.novusbio.com/images2/BRSK1-Antibody-Western-Blot-NBP1-76778-img0002.jpg)
![Western Blot: LIN-28B Antibody [NBP2-32352] - Analysis in human cell line HEK 293 and human cell line MCF-7.](http://images.novusbio.com/images2/LIN-28B-Antibody-Western-Blot-NBP2-32352-img0013.jpg)
![Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP2-32352] - Analysis in human placenta and prostate tissues. Corresponding LIN-28B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/LIN-28B-Antibody-Immunohistochemistry-Paraffin-NBP2-32352-img0014.jpg)
![Immunohistochemistry-Paraffin: LIN-28B Antibody [NBP2-32352] - Staining of human kidney, liver, placenta and prostate using Anti-LIN-28B antibody NBP2-32352 (A) shows similar protein distribution across tissues to independent antibody NBP1-85438 (B).](http://images.novusbio.com/images2/LIN-28B-Antibody-Immunohistochemistry-Paraffin-NBP2-32352-img0015.jpg)
![Immunofluorescence: TMEM38B Antibody [NBP1-77093] - Mouse thymus tissue with TMEM38B antibody at 20 ug/mL.](http://images.novusbio.com/images2/TMEM38B-Antibody-Immunofluorescence-NBP1-77093-img0003.jpg)
![Western Blot: TMEM38B Antibody [NBP1-77093] - Rat thymus tissue lysate with TMEM38B antibody at (A) 1 and (B) 2 ug/mL.](http://images.novusbio.com/images2/TMEM38B-Antibody-Western-Blot-NBP1-77093-img0001.jpg)
![Immunohistochemistry-Paraffin: TMEM38B Antibody [NBP1-77093] - Mouse thymus tissue with TMEM38B antibody at 5 ug/mL.](http://images.novusbio.com/images2/TMEM38B-Antibody-Immunohistochemistry-Paraffin-NBP1-77093-img0002.jpg)
![Western Blot: NFAT5 Antibody [NB120-3446] - Analysis of human NFAT5 from transfected BHK cell lysate.](http://images.novusbio.com/images2/NFAT5-Antibody-Western-Blot-NB120-3446-img0028.jpg)
![Western Blot: NFAT5 Antibody [NB120-3446] - Western blot image and corresponding densitometry analyses showing TonEBP/NFAT5 levels under different osmotic conditions in wild-type and Kif3a null MEFs. Kif3a null MEFs show slightly attenuated hyperosmotic increase but unaffected hypoosmotic decrease in TonEBP expression. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-019-51939-7), licensed under a CC-BY licence.](http://images.novusbio.com/images2/NFAT5-Antibody-Western-Blot-NB120-3446-img0029.jpg)
![Western Blot: NFAT5 Antibody [NB120-3446] - Western blot image showing increased TonEBP/NFAT5 expression in response to hyperosmolarity (550mOsm/kg H2O) independently of Ift88 knockdown. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-019-51939-7), licensed under a CC-BY licence.](http://images.novusbio.com/images2/NFAT5-Antibody-Western-Blot-NB120-3446-img0030.jpg)
![Western Blot: TMEM150B Antibody [NBP3-10200] - Western blot analysis of TMEM150B in Mouse Skeletal Muscle lysates. Antibody dilution at 1ug/ml](http://images.novusbio.com/images2/TMEM150B-Antibody-Western-Blot-NBP3-10200-img0001.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for ZNF483 Antibody (NBP2-88601)Discover more about diseases related to ZNF483 Antibody (NBP2-88601).
| Pathways for ZNF483 Antibody (NBP2-88601)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF483 |
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
