ZNF483 Antibody (1E7) - Azide and BSA Free

Western Blot: ZNF483 Antibody (1E7) [H00158399-M01] - Analysis of ZNF483 expression in transfected 293T cell line by ZNF483 monoclonal antibody (M01), clone 1E7.Lane 1: ZNF483 transfected lysate(28.1 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: ZNF483 Antibody (1E7) [H00158399-M01] - Detection limit for recombinant GST tagged ZNF483 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF483 Antibody (1E7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZNF483 Antibody (1E7) - Azide and BSA Free (H00158399-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZNF483 (NP_001007170.1, 142 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDSTVSQEENSKEDKMVTVCPNTESCESITLKDVAVNFSRGEWKKLEPFQKELYKEVLLENLRNLEFLDFPVSKLELISQLKWVELPWL
• Specificity: Reacts with zinc finger protein 483.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZNF483
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF483 Antibody (1E7) - Azide and BSA Free

• BMZF-2zinc finger 2, bone marrow
• BMZF2zinc finger protein 27 (KOX 22)
• Bone marrow zinc finger 2
• KOX22Zinc finger protein 233
• zinc finger protein 224
• Zinc finger protein 255Zinc finger protein KOX22
• Zinc finger protein 27
• ZNF255zinc finger protein ZNF255
• ZNF27ZNF233

Background

ZNF483 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF483
• Entrez:
  • 158399(Human)
• Uniprot:
  • NP_001007170(Human)