ZNF320 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF320 Antibody [NBP1-84114] - Staining of human cell line U-2 OS shows positivity in nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: ZNF320 Antibody [NBP1-84114] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF320 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF320
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZNF320 Protein (NBP1-84114PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF320 Antibody

  • DKFZp686G16228
  • ZFPL
  • zinc finger gene 320
  • zinc finger protein 320
  • zinc finger protein like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055023-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ZNF320 Antibody (NBP1-84114) (0)

There are no publications for ZNF320 Antibody (NBP1-84114).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF320 Antibody (NBP1-84114) (0)

There are no reviews for ZNF320 Antibody (NBP1-84114). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZNF320 Antibody (NBP1-84114) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF320 Products

Bioinformatics Tool for ZNF320 Antibody (NBP1-84114)

Discover related pathways, diseases and genes to ZNF320 Antibody (NBP1-84114). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF320 Antibody (NBP1-84114)

Discover more about diseases related to ZNF320 Antibody (NBP1-84114).
 

Pathways for ZNF320 Antibody (NBP1-84114)

View related products by pathway.

Blogs on ZNF320

There are no specific blogs for ZNF320, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF320 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF320