ZNF253 Antibody (1D7) - Azide and BSA Free

Sandwich ELISA: ZNF253 Antibody (1D7) [H00056242-M02] - Detection limit for recombinant GST tagged ZNF253 is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ZNF253 Antibody (1D7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ZNF253 Antibody (1D7) - Azide and BSA Free (H00056242-M02) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ZNF253 (NP_066385.2, 91 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYNGLNQCLTTTQKEIFQCDKYGKVFHKFSNSNTYKTRHTGINLFKCIICGKA
• Specificity: ZNF253 - zinc finger protein 253 (1D7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ZNF253
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF253 Antibody (1D7) - Azide and BSA Free

• BA526D8.4
• FLJ33884
• KRAB box containing C2H2 type zinc finger bA526D8.4
• MGC133033
• MGC133034
• zinc finger protein 484

Background

ZNF253 may function as a transcription factor. Seem to have a transcriptional repression activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF253
• Entrez:
  • 56242(Human)
• Uniprot:
  • NP_066385(Human)