Recombinant Human ZNF214 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF214 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 210-319 of Human ZNF214 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LRDSMEEKYCGCNKCKGIYYWNSRCVFHKRNQPGENLCQCSIRKACFSQRSDLYRHPRNHIGKKLYGCDEVDGNFHQSSGVHFHQRVHIGEVPYSCNACGKSFSQISSLH

Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF214

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF214 Protein

  • BAZ 1
  • BAZ1
  • BAZ-1
  • BWSCR2-Associated Zinc Finger Protein 1
  • DKFZp564D0764
  • Early hematopoietic zinc finger protein
  • early hematopoietic zinc finger
  • EHZFLIP3
  • Evi3
  • LYST-interacting protein 3
  • MGC142182
  • MGC142208
  • zinc finger protein 521

Background

ZNF214 - zinc finger protein 214

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007762-B01P
Species: Hu
Applications: WB, ICC/IF
NBL1-11664
Species: Hu
NBP1-81223
Species: Hu
Applications: IHC, IHC-P
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2832
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00057492-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NLS6636
Species: Hu
Applications: IHC-P
H00007761-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF214 Partial Recombinant Protein (H00007761-Q01) (0)

There are no publications for ZNF214 Partial Recombinant Protein (H00007761-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF214 Partial Recombinant Protein (H00007761-Q01) (0)

There are no reviews for ZNF214 Partial Recombinant Protein (H00007761-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF214 Partial Recombinant Protein (H00007761-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZNF214 Products

Bioinformatics Tool for ZNF214 Partial Recombinant Protein (H00007761-Q01)

Discover related pathways, diseases and genes to ZNF214 Partial Recombinant Protein (H00007761-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF214 Partial Recombinant Protein (H00007761-Q01)

Discover more about diseases related to ZNF214 Partial Recombinant Protein (H00007761-Q01).
 

Pathways for ZNF214 Partial Recombinant Protein (H00007761-Q01)

View related products by pathway.

Blogs on ZNF214

There are no specific blogs for ZNF214, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARID1B Antibody (2D2)
H00057492-M01
ZNF214 Antibody
NBP2-31602
Caspr2 Antibody
NBP1-88182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF214 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF214