Recombinant Human ZNF181 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZNF181 Protein Summary

Description
ZNF181 (Human) GST-Tagged Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FIHRSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSI
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ZNF181

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZNF181 Protein

  • zinc finger protein 181

Background

ZNF181 - zinc finger protein 181 (HHZ181)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15169
Species: Hu
Applications: WB, ICC/IF
NBP1-79358
Species: Hu
Applications: WB
NBP2-13577
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92613
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NBP1-82038
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NB110-61626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00126374-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-30747
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81344
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00339318-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZNF181 Partial Recombinant Protein (H00339318-Q01) (0)

There are no publications for ZNF181 Partial Recombinant Protein (H00339318-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF181 Partial Recombinant Protein (H00339318-Q01) (0)

There are no reviews for ZNF181 Partial Recombinant Protein (H00339318-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF181 Partial Recombinant Protein (H00339318-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human ZNF181 Protein Products

Related Products by Gene

Bioinformatics Tool for ZNF181 Partial Recombinant Protein (H00339318-Q01)

Discover related pathways, diseases and genes to ZNF181 Partial Recombinant Protein (H00339318-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF181 Partial Recombinant Protein (H00339318-Q01)

Discover more about diseases related to ZNF181 Partial Recombinant Protein (H00339318-Q01).
 

Pathways for ZNF181 Partial Recombinant Protein (H00339318-Q01)

View related products by pathway.

Blogs on ZNF181

There are no specific blogs for ZNF181, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZNF181 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF181

Customers Who Bought This Also Bought

ZNF181 Antibody
NBP1-92618
ZNF181 Antibody
NBP1-92618
ZNF181 Antibody
NBP1-92618