ZNF101 Antibody

Images

 
Western Blot: ZNF101 Antibody [NBP1-68923] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF101 Antibody Summary

Immunogen
Synthetic peptides corresponding to ZNF101 (zinc finger protein 101) The peptide sequence was selected from the N terminal of ZNF101. Peptide sequence EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF101
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ZNF101 and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF101 Antibody

  • DKFZp570I0164
  • HZF12
  • MGC149565
  • MGC149566
  • zinc finger protein 101 (Y2)
  • zinc finger protein 101
  • zinc finger protein 12
  • Zinc finger protein HZF12

Background

Zinc finger proteins (ZNFs), such as ZNF101, bind nucleic acids and perform many key functions, the most important of which is regulating transcription (summary by Bellefroid et al., 1993 [PubMed 8467795]). See ZNF91 (MIM 603971) for general information on ZNFs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80912
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-33094
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79225
Species: Hu
Applications: WB

Publications for ZNF101 Antibody (NBP1-68923) (0)

There are no publications for ZNF101 Antibody (NBP1-68923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF101 Antibody (NBP1-68923) (0)

There are no reviews for ZNF101 Antibody (NBP1-68923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF101 Antibody (NBP1-68923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF101 Products

Bioinformatics Tool for ZNF101 Antibody (NBP1-68923)

Discover related pathways, diseases and genes to ZNF101 Antibody (NBP1-68923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF101

There are no specific blogs for ZNF101, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF101 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF101
Uniprot