Recombinant Human ZMYND19 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZMYND19 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 227 of Human ZMYND19 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZMYND19

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZMYND19 Protein

  • MCH-R1-interacting zinc finger protein
  • Melanin-concentrating hormone receptor 1-interacting zinc finger protein
  • MIZIPmelanin-concentrating hormone receptor 1 interacting zinc-finger protein
  • RP11-48C7.4
  • zinc finger MYND domain-containing protein 19
  • zinc finger, MYND domain containing 19
  • zinc finger, MYND-type containing 19

Background

ZMYND19 is a MYND zinc finger domain-containing protein that binds to the C terminus of melanin-concentrating hormone receptor-1 (MCHR1; MIM 601751) (Bachner et al., 2002 [PubMed 12208518]), and to the N termini of alpha-tubulin (TUBA1; MIM 191110), and beta-tubulin (TUBB; MIM 191130) (Francke et al., 2005 [PubMed 16039987]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7938
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-13780
Species: Hu
Applications: IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-47489
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00116225-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZMYND19 Recombinant Protein (H00116225-P01) (0)

There are no publications for ZMYND19 Recombinant Protein (H00116225-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMYND19 Recombinant Protein (H00116225-P01) (0)

There are no reviews for ZMYND19 Recombinant Protein (H00116225-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZMYND19 Recombinant Protein (H00116225-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZMYND19 Products

Bioinformatics Tool for ZMYND19 Recombinant Protein (H00116225-P01)

Discover related pathways, diseases and genes to ZMYND19 Recombinant Protein (H00116225-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZMYND19 Recombinant Protein (H00116225-P01)

View related products by pathway.

Blogs on ZMYND19

There are no specific blogs for ZMYND19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZMYND19 Antibody
NBP1-81047

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZMYND19 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMYND19