![Western Blot: ZCCHC13 Antibody [H00389874-B01P] - Analysis of ZCCHC13 expression in transfected 293T cell line by ZCCHC13 polyclonal antibody. Lane 1: ZCCHC13 transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ZCCHC13-Antibody-Western-Blot-H00389874-B01P-img0002.jpg "Western Blot: ZCCHC13 Antibody [H00389874-B01P] - Analysis of ZCCHC13 expression in transfected 293T cell line by ZCCHC13 polyclonal antibody. Lane 1: ZCCHC13 transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | ZCCHC13 (NP_976048.1, 1 a.a. - 166 a.a.) full-length human protein. MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ZCCHC13 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot, Functional, Immunofluorescence |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZCCHC13 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: ZCCHC13 Antibody [H00389874-B01P] - Analysis of purified antibody to ZCCHC13 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/ZCCHC13-Antibody-Immunocytochemistry-Immunofluorescence-H00389874-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: ZCCHC13 Antibody [H00389874-B01P] - Analysis of purified antibody to ZCCHC13 on HeLa cell. (antibody concentration 10 ug/ml)")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")