XP32 Antibody


Immunocytochemistry/ Immunofluorescence: XP32 Antibody [NBP3-17559] - Staining of human cell line HaCaT shows localization to plasma membrane.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

XP32 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CQTYVKCPAPCQTTYVKCPTPCQTYVKCPAPCQMTYIKSPAPCQTQTCYVQGASPCQSYYVQAPASGSTSQYCVT
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for XP32 Antibody

  • C1orf68
  • chromosome 1 open reading frame 68
  • LEP7
  • skin-specific protein (xp32)
  • skin-specific protein 32
  • XP32


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for XP32 Antibody (NBP3-17559) (0)

There are no publications for XP32 Antibody (NBP3-17559).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XP32 Antibody (NBP3-17559) (0)

There are no reviews for XP32 Antibody (NBP3-17559). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for XP32 Antibody (NBP3-17559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional XP32 Products

Array NBP3-17559

Bioinformatics Tool for XP32 Antibody (NBP3-17559)

Discover related pathways, diseases and genes to XP32 Antibody (NBP3-17559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on XP32

There are no specific blogs for XP32, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our XP32 Antibody and receive a gift card or discount.


Gene Symbol C1orf68