UTP11L Antibody

Images

 
Western Blot: UTP11L Antibody [NBP3-09907] - Western blot analysis of UTP11L in Hela Whole Cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UTP11L Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human UTP11LL (NP_057121). Peptide sequence AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA
Clonality
Polyclonal
Host
Rabbit
Gene
UTP11, UTP11L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for UTP11L Antibody

  • CGI94
  • CGI-94
  • probable U3 small nucleolar RNA-associated protein 11
  • U3 snoRNA-associated protein 11
  • UTP11-like protein
  • UTP11-like, U3 small nucleolar ribonucleoprotein, (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-09907
Species: Hu
Applications: WB

Publications for UTP11L Antibody (NBP3-09907) (0)

There are no publications for UTP11L Antibody (NBP3-09907).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTP11L Antibody (NBP3-09907) (0)

There are no reviews for UTP11L Antibody (NBP3-09907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UTP11L Antibody (NBP3-09907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UTP11L Products

Bioinformatics Tool for UTP11L Antibody (NBP3-09907)

Discover related pathways, diseases and genes to UTP11L Antibody (NBP3-09907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for UTP11L Antibody (NBP3-09907)

Find related products by research area.

Blogs on UTP11L

There are no specific blogs for UTP11L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTP11L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTP11, UTP11L