USH1C Recombinant Protein Antigen

Images

 
There are currently no images for USH1C Recombinant Protein Antigen (NBP1-89189PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

USH1C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USH1C.

Source: E. coli

Amino Acid Sequence: IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
USH1C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89189.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USH1C Recombinant Protein Antigen

  • AIE75
  • AIE-75
  • Antigen NY-CO-38/NY-CO-37
  • Autoimmune enteropathy-related antigen AIE-75
  • deafness, autosomal recessive 18
  • DFNB18
  • harmonin
  • NY-CO-37
  • NY-CO-38
  • PDZ-45
  • PDZ73
  • PDZ-73
  • PDZ-73/NY-CO-38
  • Protein PDZ-73
  • Renal carcinoma antigen NY-REN-3
  • ush1cpst
  • Usher syndrome 1C (autosomal recessive, severe)
  • Usher syndrome type-1C protein

Background

USH1C may be involved in protein-protein interaction. Defects in USH1C are the cause of Usher syndrome type 1c. It is an autosomal recessive sensory defect involving congenital profound sensorineural deafness, vestibular dysfunction, and blindness due to progressive retinitis pigmentosa. Defects in USH1C are also the cause of nonsyndromic recessive deafness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-21878
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NBP3-03833
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-89076
Species: Ca, Hu
Applications: IHC, IHC-P, WB
NBP1-69142
Species: Hu
Applications: WB
NBP2-57048
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00025861-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-85885
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-17529
Species: Hu
Applications: ICC/IF
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87850
Species: Hu
Applications: IHC, IHC-P

Publications for USH1C Recombinant Protein Antigen (NBP1-89189PEP) (0)

There are no publications for USH1C Recombinant Protein Antigen (NBP1-89189PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USH1C Recombinant Protein Antigen (NBP1-89189PEP) (0)

There are no reviews for USH1C Recombinant Protein Antigen (NBP1-89189PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for USH1C Recombinant Protein Antigen (NBP1-89189PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USH1C Products

Research Areas for USH1C Recombinant Protein Antigen (NBP1-89189PEP)

Find related products by research area.

Blogs on USH1C.

Auditory Infographic: Can you hear me now?
The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below. Novus Biologicals offers reagents mentioned in the inf...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our USH1C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol USH1C